PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002551P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 230aa    MW: 26483.7 Da    PI: 10.695
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002551P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d++++ G g+W+t ++  g+ R++k+c++rw +yl
   MELO3C002551P1 14 KGPWTPEEDQKLIDYIQKNGHGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.23.3e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia +++ gRt++++k++w+++
   MELO3C002551P1  67 RGRFSFEEEETIIQLHSVLGNK-WSAIATRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.36965IPR017930Myb domain
SuperFamilySSF466897.86E-3211108IPR009057Homeodomain-like
SMARTSM007172.1E-141363IPR001005SANT/Myb domain
PfamPF002494.4E-171461IPR001005SANT/Myb domain
CDDcd001671.83E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2665116IPR009057Homeodomain-like
SMARTSM007177.4E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.44466116IPR017930Myb domain
PfamPF002491.6E-1567111IPR001005SANT/Myb domain
CDDcd001677.83E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRTPCCDKN GLKKGPWTPE EDQKLIDYIQ KNGHGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVLGNKWS AIATRLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILR STLYNSSQMN LSSLLGVQPL VNPELLKLAA SLMSSERKSP  180
SFSPQNSSHT KKILQLPFNS PILSYKCKFL CKKLFNSLHK WWNQILRVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30121165108B-MYB
1h8a_C1e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004146632.11e-130PREDICTED: protein ODORANT1-like
RefseqXP_008441942.11e-129PREDICTED: transcription factor MYB86-like
SwissprotQ8GWP06e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0U3IU111e-112A0A0U3IU11_MESCR; MYB transcription factor
TrEMBLF6I7381e-112F6I738_VITVI; Putative uncharacterized protein
STRINGVIT_00s0203g00070.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.17e-96MYB-like 102